| Bioactivity | Tat-beclin 1 scrambled TFA is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a region of the autophagy protein, beclin 1. beclin 1 induces autophagy via binding human immunodeficiency virus, HIV-1 Nef and interacting with negative regulator GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens, such as HIV-1. Tat-beclin 1 also reduces mortality in mice infected with chikungunya or West Nile virus[1]. | ||||||
| Name | Tat-beclin 1 scrambled TFA | ||||||
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Val-Gly-Asn-Asp-Phe-Phe-Ile-Asn-His-Glu-Thr-Thr-Gly-Phe-Ala-Thr-Glu-Trp | ||||||
| Shortening | YGRKKRRQRRRGGVGNDFFINHETTGFATEW | ||||||
| Formula | C164H251N57O45 | ||||||
| Molar Mass | 3855.12 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
||||||
| Reference | [1]. Shoji-Kawata S, et al. Identification of a candidate therapeutic autophagy-inducing peptide. Nature. 2013 Feb 14;494(7436):201-6. |