| Bioactivity | Tat-HA-NR2B9 contains a fragment of the cellmembrane transduction domain of HIV-1 Tat, a influenza virus hemagglutinin (HA) epitope-tag, and the C-terminal 9 amino acids of NR2B (NR2B9c). Tat-HA-NR2B9 reduces infarct size and improves neurological functions in ischemia-induced cerebral injury in the rats[1] |
| Name | Tat-HA-NR2B9c |
| Sequence | Pro-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Gly-Lys-Leu-Ser-Ser-Ile-Glu-Ser-Asp-Val |
| Shortening | PGYGRKKRRQRRRGYPYDVPDYAGKLSSIESDV |
| Formula | C169H269N55O50 |
| Molar Mass | 3871.28 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Zhou HH, et al. Cloning, expression, and purification of a recombinant Tat-HA-NR2B9c peptide. Protein Expr Purif. 2012 Oct;85(2):239-45. |