PeptideDB

Tamapin TFA

CAS: F: C146H238N44O41S6.xC2HF3O2 W: 3458.11 (free base)

Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a sel
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus)[1].
Name Tamapin TFA
Sequence Ala-Phe-Cys-Asn-Leu-Arg-Arg-Cys-Glu-Leu-Ser-Cys-Arg-Ser-Leu-Gly-Leu-Leu-Gly-Lys-Cys-Ile-Gly-Glu-Glu-Cys-Lys-Cys-Val-Pro-Tyr-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28)
Shortening AFCNLRRCELSCRSLGLLGKCIGEECKCVPY-NH2 (Disulfide bridge: Cys3-Cys21, Cys8-Cys26, Cys12-Cys28)
Formula C146H238N44O41S6.xC2HF3O2
Molar Mass 3458.11 (free base)
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Pedarzani P, et al. Tamapin, a venom peptide from the Indian red scorpion (Mesobuthus tamulus) that targets small conductance Ca2+-activated K+ channels and afterhyperpolarization currents in central neurons. J Biol Chem. 2002 Nov 29;277(48):46101-9.