| Bioactivity | TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1]. | ||||||
| Name | TIP 39, Tuberoinfundibular Neuropeptide | ||||||
| CAS | 277302-47-3 | ||||||
| Shortening | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP | ||||||
| Formula | C202H325N61O54S | ||||||
| Molar Mass | 4504.20 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Della Penna K, et al. Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor. Neuropharmacology. 2003 Jan;44(1):141-53. |
TIP 39, Tuberoinfundibular Neuropeptide
CAS: 277302-47-3 F: C202H325N61O54S W: 4504.20
TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.