| Bioactivity | TGF α (1-50) (rat) TGF alpha (1-50) (rat) is an anti-inflammatory peptide useful in the study of inflammation and immunity[1]. |
| Name | TGF α (1-50) (rat) |
| CAS | 89899-53-6 |
| Sequence | Val-Val-Ser-His-Phe-Asn-Lys-Cys-Pro-Asp-Ser-His-Thr-Gln-Tyr-Cys-Phe-His-Gly-Thr-Cys-Arg-Phe-Leu-Val-Gln-Glu-Glu-Lys-Pro-Ala-Cys-Val-Cys-His-Ser-Gly-Tyr-Val-Gly-Val-Arg-Cys-Glu-His-Ala-Asp-Leu-Leu-Ala (Disulfide bridge:Cys8-Cys21;Cys16-Cys32;Cys34-Cys43) |
| Shortening | VVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA (Disulfide bridge:Cys8-Cys21;Cys16-Cys32;Cys34-Cys43) |
| Formula | C244H361N71O71S6 |
| Molar Mass | 5617.30 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Hazarika P, et al. Epitope mapping of alpha-transforming growth factor: evidence of an immunodominant region. Life Sci. 1988;42(24):2525-31. |
TGF α (1-50) (rat)
CAS: 89899-53-6 F: C244H361N71O71S6 W: 5617.30
TGF α (1-50) (rat) TGF alpha (1-50) (rat) is an anti-inflammatory peptide useful in the study of inflammation and immun
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.