TAT-NSF700 Fusion Peptide_product_DataBase

CAS: F: C188H318N62O45 W: 4166.92

TAT-NSF700 Fusion Peptide is a potent N-ethyl-maleimide-sensitive factor (NSF) inhibitor. TAT-NSF700 Fusion Peptide can

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	TAT-NSF700 Fusion Peptide is a potent N-ethyl-maleimide-sensitive factor (NSF) inhibitor. TAT-NSF700 Fusion Peptide can readily permeate the cell membrane and interact with the intracellular organelle directly[1].
Name	TAT-NSF700 Fusion Peptide
Sequence	Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Leu-Leu-Asp-Tyr-Val-Pro-Ile-Gly-Pro-Arg-Phe-Ser-Asn-Leu-Val-Leu-Gln-Ala-Leu-Leu-Val-Leu
Shortening	YGRKKRRQRRRGGGLLDYVPIGPRFSNLVLQALLVL
Formula	C188H318N62O45
Molar Mass	4166.92
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

PeptideDB