| Bioactivity | TAT-NSF222scr Fusion Polypeptide, scrambled is a control peptide of TAT-NSF700 Fusion Peptide (HY-P4113). TAT-NSF222scr Fusion Polypeptide, scrambled is consisted of the intact TAT domain followed by the amino acid residues of NSF 222-243 in a scrambled order[1]. |
| Name | TAT-NSF222scr Fusion Polypeptide, scrambled |
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Glu-Asn-Ser-Phe-Arg-Phe-Leu-Ala-Asp-Ile-Phe-Pro-Ala-Lys-Ala-Phe-Pro-Val-Arg-Phe-Glu |
| Shortening | YGRKKRRQRRRGGGENSFRFLADIFPAKAFPVRFE |
| Formula | C190H298N64O46 |
| Molar Mass | 4214.80 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Matsushita K, et al. Nitric oxide regulates exocytosis by S-nitrosylation of N-ethylmaleimide-sensitive factor. Cell. 2003 Oct 17;115(2):139-50. |
TAT-NSF222scr Fusion Polypeptide, scrambled
CAS: F: C190H298N64O46 W: 4214.80
TAT-NSF222scr Fusion Polypeptide, scrambled is a control peptide of TAT-NSF700 Fusion Peptide (HY-P4113). TAT-NSF222scr
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.