| Bioactivity | TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocytosis, and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF). TAT-NSF222 Fusion Peptide is an exocytosis inhibitor[1]. |
| Name | TAT-NSF222 Fusion Peptide |
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Leu-Asp-Lys-Glu-Phe-Asn-Ser-Ile-Phe-Arg-Arg-Ala-Phe-Ala-Ser-Arg-Val-Phe-Pro-Pro-Glu |
| Shortening | YGRKKRRQRRRGGGLDKEFNSIFRRAFASRVFPPE |
| Formula | C187H301N67O47 |
| Molar Mass | 4239.81 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
TAT-NSF222 Fusion Peptide
CAS: F: C187H301N67O47 W: 4239.81
TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocy
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.