| Bioactivity | TAT-N24 is a cell-permeable TAT peptide as a p55PIK signaling inhibitor. TAT-N24 can treat corneal neovascularization (CNV) and ocular inflammation by inhibiting the HIF-1α/NF-κB signaling pathway in corneal suture (CS). TAT-N24 also inhibit corneal neovascularization[1]. |
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Met-Asp-Arg-Asp-Asp-Ala-Asp-Trp-Arg-Glu-Val-Met-Met-Pro-Tyr-Ser-Thr-Glu-Leu-Ile-Phe-Tyr-Ile-Glu |
| Shortening | YGRKKRRQRRRMDRDDADWREVMMPYSTELIFYIE |
| Formula | C198H313N63O56S3 |
| Molar Mass | 4568.19 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Huang J, et al. A cell-permeable peptide inhibitor of p55PIK signaling alleviates suture-induced corneal neovascularization and inflammation. Heliyon. 2023 Mar 31;9(4):e14869. |