| Bioactivity | TAT-M2NX (tatM2NX) is a TRPM2 inhibitor with specific neuroprotective activity in male mice. TAT-M2NX can be used to study ischemic neuronal damage[1]. |
| Target | TRPM2. |
| Name | TAT-M2NX |
| CAS | 2126166-03-6 |
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Ser-Arg-Glu-Pro-Gly-Glu-Met-Leu-Pro-Arg-Lys-Leu-Lys-Arg-Val-Leu-Arg-Gln-Glu-Phe-Trp-Val |
| Shortening | YGRKKRRQRRRGSREPGEMLPRKLKRVLRQEFWV |
| Formula | C190H323N71O45S |
| Molar Mass | 4354.11 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Shimizu T, et al. Extended therapeutic window of a novel peptide inhibitor of TRPM2 channels following focal cerebral ischemia. Exp Neurol. 2016 Sep;283(Pt A):151-6. |
TAT-M2NX
CAS: 2126166-03-6 F: C190H323N71O45S W: 4354.11
TAT-M2NX (tatM2NX) is a TRPM2 inhibitor with specific neuroprotective activity in male mice. TAT-M2NX can be used to stu
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.