| Bioactivity | TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes[1]. |
| Name | TAT-JBD20 |
| Sequence | Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Pro-Arg-Pro-Lys-Arg-Pro-Thr-Thr-Leu-Asn-Leu-Phe-Pro-Gln-Val-Pro-Arg-Ser-Gln-Asp-Thr-NH2 |
| Shortening | GRKKRRQRRRPPRPKRPTTLNLFPQVPRSQDT-NH2 |
| Formula | C168H293N67O42 |
| Molar Mass | 3923.55 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Alikhani M, et al. Advanced glycation end products induce apoptosis in fibroblasts through activation of ROS, MAP kinases, and the FOXO1 transcription factor. Am J Physiol Cell Physiol. 2007 Feb;292(2):C850-6. [2]. Kaneto H, et al. Oxidative stress, ER stress, and the JNK pathway in type 2 diabetes. J Mol Med (Berl). 2005 Jun;83(6):429-39. |