| Bioactivity | TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety[1]. | ||||||
| Name | TAT-HA2 Fusion Peptide | ||||||
| CAS | 923954-79-4 | ||||||
| Sequence | Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly | ||||||
| Shortening | RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG | ||||||
| Formula | C149H243N53O39S | ||||||
| Molar Mass | 3432.92 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
||||||
| Reference | [1]. Ya-Jung Lee, et al. Modeling of the endosomolytic activity of HA2-TAT peptides with red blood cells and ghosts. Biochemistry. 2010 Sep 14;49(36):7854-66. |
TAT-HA2 Fusion Peptide
CAS: 923954-79-4 F: C149H243N53O39S W: 3432.92
TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenz
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.