| Bioactivity | TAT-DEF-Elk-1 (TDE) is a cell-penetrating peptide inhibitor of Elk-1, mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity[1]. | ||||||
| Invitro | Elk-1 phosphorylation on Ser383/389 has a dual function and triggers both Elk-1 nuclear translocation and SRE-dependent gene expression[1].TAT-DEF-Elk-1 (5-10 μM; 1 hour) specifically inhibits glutamate-induced elk-1 activation and does not interfer with ERK, MSK-1, or CREB phosphorylation[1].TAT-DEF-Elk-1 (5 μM; 2 hour) treatment shows a significant inhibition of c-Fos, Zif268 and JunB, but has no effects on c-Jun expression[1]. Western Blot Analysis[1] Cell Line: | ||||||
| Name | TAT-DEF-Elk-1 | ||||||
| CAS | 1220751-16-5 | ||||||
| Shortening | GRKKRRQRRRPPSPAKLSFQFPSSGSAQVHI | ||||||
| Formula | C155H259N57O40 | ||||||
| Molar Mass | 3561.07 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
TAT-DEF-Elk-1
CAS: 1220751-16-5 F: C155H259N57O40 W: 3561.07
TAT-DEF-Elk-1 (TDE) is a cell-penetrating peptide inhibitor of Elk-1, mimics and specifically interferes with the DEF
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.