| Bioactivity | TatCN21 is a potent and selective inhibitor peptide for the calcium/calmodulin-dependent protein kinase II (CaMKII), a ubiquitously-expressed multifunctional serine/threonine protein kinase, with an IC50 of 77 nM. TatCN21 can be utilized in research on ischemia and neurodegenerative diseases[1]. |
| Sequence | Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Lys-Arg-Pro-Pro-Lys-Leu-Gly-Gln-Ile-Gly-Arg-Ser-Lys-Arg-Val-Val-Ile-Glu-Asp-Asp-Arg |
| Shortening | YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR |
| Formula | C169H303N69O43 |
| Molar Mass | 3989.65 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Ashpole NM, et al. Excitotoxic neuroprotection and vulnerability with CaMKII inhibition. Mol Cell Neurosci. 2011 Apr;46(4):720-30. |