PeptideDB

Ssm spooky toxin

CAS: F: C270H413N69O79S4 W: 6017.84

Ssm Spooky Toxin from?Scolopendra mutilans, exhibits lethal toxicity in hematological and respiratory systems by potentl
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Ssm Spooky Toxin from?Scolopendra mutilans, exhibits lethal toxicity in hematological and respiratory systems by potently inhibiting KCNQ (voltage-gated potassium channel family 7) channels, with IC50? of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin plays an essential role in the centipede’s circulatory system[1] [2][3].
Name Ssm spooky toxin
Sequence Glu-Val-Ile-Lys-Lys-Asp-Thr-Pro-Tyr-Lys-Lys-Arg-Lys-Phe-Pro-Tyr-Lys-Ser-Glu-Cys-Leu-Lys-Ala-Cys-Ala-Thr-Ser-Phe-Thr-Gly-Gly-Asp-Glu-Ser-Arg-Ile-Gln-Glu-Gly-Lys-Pro-Gly-Phe-Phe-Lys-Cys-Thr-Cys-Tyr-Phe-Thr-Thr-Gly (Disulfide bridge: Cys20-Cys46, Cys24-Cys48)
Shortening EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG (Disulfide bridge: Cys20-Cys46, Cys24-Cys48)
Formula C270H413N69O79S4
Molar Mass 6017.84
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Canwei Du, et al. Centipede KCNQ Inhibitor SsTx Also Targets KV1.3. Toxins (Basel). 2019 Feb; 11(2): 76. [2]. Shilong Yang, et al. Target switch of centipede toxins for antagonistic switch. Sci Adv. 2020 Aug 7;6(32):eabb5734. [3]. Anna Luo, et al. Centipede Venom: A Potential Source of Ion Channel Modulators. Int J Mol Sci.2022 Jun 26;23(13):7105.