| Bioactivity | Ssm Spooky Toxin from?Scolopendra mutilans, exhibits lethal toxicity in hematological and respiratory systems by potently inhibiting KCNQ (voltage-gated potassium channel family 7) channels, with IC50? of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin plays an essential role in the centipede’s circulatory system[1] [2][3]. |
| Name | Ssm spooky toxin |
| Sequence | Glu-Val-Ile-Lys-Lys-Asp-Thr-Pro-Tyr-Lys-Lys-Arg-Lys-Phe-Pro-Tyr-Lys-Ser-Glu-Cys-Leu-Lys-Ala-Cys-Ala-Thr-Ser-Phe-Thr-Gly-Gly-Asp-Glu-Ser-Arg-Ile-Gln-Glu-Gly-Lys-Pro-Gly-Phe-Phe-Lys-Cys-Thr-Cys-Tyr-Phe-Thr-Thr-Gly (Disulfide bridge: Cys20-Cys46, Cys24-Cys48) |
| Shortening | EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG (Disulfide bridge: Cys20-Cys46, Cys24-Cys48) |
| Formula | C270H413N69O79S4 |
| Molar Mass | 6017.84 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Canwei Du, et al. Centipede KCNQ Inhibitor SsTx Also Targets KV1.3. Toxins (Basel). 2019 Feb; 11(2): 76. [2]. Shilong Yang, et al. Target switch of centipede toxins for antagonistic switch. Sci Adv. 2020 Aug 7;6(32):eabb5734. [3]. Anna Luo, et al. Centipede Venom: A Potential Source of Ion Channel Modulators. Int J Mol Sci.2022 Jun 26;23(13):7105. |