Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)_product_DataBase

Bioactivity	Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.
Invitro	Sphistin is a synthetic 38-amino acid H2A derived peptide from Scylla paramamosain. Sphistin Synthetic Peptide (12-38) shows a stronger activity with a much lower minimum inhibitory concentration (3 mM) against Staphylococcus aureus, Corynebacterium glutamicum, Micrococcus lysodeikticus Fleming, Bacillus subtilis, Pseudomonas fluorescens, Aeromonas hydrophila and A. sobria in comparison with the reported Sphistin. A leakage of intracellular content is described in E. coli treated with Sphistin Synthetic Peptide (12-38). Unlike Sphistin which mainly disrupts the membrane integrity, Sphistin Synthetic Peptide (12-38) could also combine the A. sobria genomic DNA with a minimum concentration of 6 mM and is located intracellularly in cells observed under confocal laser scanning microscope imaging[1].
Name	Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)
Shortening	FITC-KAKAKAVSRSARAGLQFPVGRIHRHLK
Formula	C159H250N50O37S
Molar Mass	3486.06
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

PeptideDB