| Bioactivity | Slotoxin, a peptide from Centruroides noxius Hoffmann scorpion venom, blocks high conductance calcium-activated potassium channel, with Kd of 1.5 nM[1]. |
| Target | others |
| Name | Slotoxin |
| Sequence | Thr-Phe-Ile-Asp-Val-Asp-Cys-Thr-Val-Ser-Lys-Glu-Cys-Trp-Ala-Pro-Cys-Lys-Ala-Ala-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Lys-Cys-Tyr-Val (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35) |
| Shortening | TFIDVDCTVSKECWAPCKAAFGVDRGKCMGKKCKCYV (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35) |
| Formula | C177H275N47O50S7 |
| Molar Mass | 4085.82 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Garcia-Valdes J, et al. Slotoxin, αKTx1.11, a new scorpion peptide blocker of MaxiK channels that differentiates between α and α+β (β1 or β4) complexes. FEBS Lett. 505 (3): 369–73. |