PeptideDB

Slotoxin

CAS: F: C177H275N47O50S7 W: 4085.82

Slotoxin, a peptide from Centruroides noxius Hoffmann scorpion venom, blocks high conductance calcium-activated potassiu
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Slotoxin, a peptide from Centruroides noxius Hoffmann scorpion venom, blocks high conductance calcium-activated potassium channel, with Kd of 1.5 nM[1].
Target others
Name Slotoxin
Sequence Thr-Phe-Ile-Asp-Val-Asp-Cys-Thr-Val-Ser-Lys-Glu-Cys-Trp-Ala-Pro-Cys-Lys-Ala-Ala-Phe-Gly-Val-Asp-Arg-Gly-Lys-Cys-Met-Gly-Lys-Lys-Cys-Lys-Cys-Tyr-Val (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35)
Shortening TFIDVDCTVSKECWAPCKAAFGVDRGKCMGKKCKCYV (Disulfide bridge: Cys7-Cys28; Cys13-Cys33; Cys17-Cys35)
Formula C177H275N47O50S7
Molar Mass 4085.82
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Garcia-Valdes J, et al. Slotoxin, αKTx1.11, a new scorpion peptide blocker of MaxiK channels that differentiates between α and α+β (β1 or β4) complexes. FEBS Lett. 505 (3): 369–73.