| Bioactivity | SjDX5-271 is a small 3 kDa peptide. SjDX5-271 inhibits the TLR4/MyD88/NF-κB signaling pathway. SjDX5-271 induces cell polarization. SjDX5-271 alleviats hepatic inflammation. SjDX5-271 protects mice against liver ischemia-reperfusion injury[1]. |
| CAS | 2767993-76-8 |
| Sequence | Tyr-Lys-Asn-Leu-Gly-Gly-Gln-Gln-Gln-Ser-Gly-Ser-Ser-Gln-Gly-Gln-Phe-Pro-Ser-Gly-Gln-Met-Gln-Gln-Gln-Gln-Arg-Pro-Gln-Gln |
| Shortening | YKNLGGQQQSGSSQGQFPSGQMQQQQRPQQ |
| Formula | C137H215N47O49S |
| Molar Mass | 3336.52 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Xu X, et al. Novel anti-inflammatory peptide alleviates liver ischemia-reperfusion injury. J Biomed Res. 2024 May 29;39(1):61-75. |