| Bioactivity | Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes[1]. |
| Name | Secretoneurin, rat |
| CAS | 149146-12-3 |
| Sequence | Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Ser-Asn-Gln |
| Shortening | TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ |
| Formula | C159H252N40O58 |
| Molar Mass | 3651.95 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Secretoneurin, rat
CAS: 149146-12-3 F: C159H252N40O58 W: 3651.95
Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secr
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.