PeptideDB

Secretoneurin, rat

CAS: 149146-12-3 F: C159H252N40O58 W: 3651.95

Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secr
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes[1].
Name Secretoneurin, rat
CAS 149146-12-3
Sequence Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Ser-Asn-Gln
Shortening TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
Formula C159H252N40O58
Molar Mass 3651.95
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.