PeptideDB

Scyllatoxin

CAS: 142948-19-4 F: C142H237N45O39S7 W: 3423.15

Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriat
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo[1].
Invitro For scyllatoxin, the Arg6 and Arg13 are essential for binding to the Ca2+-activated K+ channel protein and for the functional effect of the toxin[1].For scyllatoxin, His31 is important for the binding activity of the toxin and for the induction of contractions on taenia coli[1].
Name Scyllatoxin
CAS 142948-19-4
Shortening AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 (Disulfide bridge: Cys3-Cys21; Cys8-Cys26; Cys12-Cys28)
Formula C142H237N45O39S7
Molar Mass 3423.15
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.