| Bioactivity | Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo[1]. |
| Invitro | For scyllatoxin, the Arg6 and Arg13 are essential for binding to the Ca2+-activated K+ channel protein and for the functional effect of the toxin[1].For scyllatoxin, His31 is important for the binding activity of the toxin and for the induction of contractions on taenia coli[1]. |
| Name | Scyllatoxin |
| CAS | 142948-19-4 |
| Shortening | AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH-NH2 (Disulfide bridge: Cys3-Cys21; Cys8-Cys26; Cys12-Cys28) |
| Formula | C142H237N45O39S7 |
| Molar Mass | 3423.15 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |