| Bioactivity | SPAI-1 is a specific inhibitor for monovalent cation transporting ATPases. SPAI-1 is a peptide isolated from porcine duodenum, inhibits Na+, K+-ATPase and H+, K+-ATPase in vitro, stimulates Mg2+-ATPase[1][2]. |
| Invitro | SPAI-1 (10 nM; 2.5 hr) inhibits Na+, K+-ATPase by the competitive mode against Na+ and is uncompetitive with K+. The IC50 of Na+, K+-ATPase inhibition effect is 0.12 μM[1].SPAI-1 (3-10 μM; 10 or 20 min) significantly inhibits Na+, K+-ATPase[2]. SPAI-1 (0.1-100 μM; 10 or 20 min) shows light difference between enzyme preparations from dog and rat. As isoforms of Na+, K+-ATPase obtained from rats, SPAI-1 shows inhibition with IC50s of 8.7-24.6 μM; as for isoforms of Na+, K+-ATPase obtained from dog, SPAI-1 shows inhibition with IC50s of 11.6-17.5 μM[2].SPAI-1 (0.1-100 μM; 10 or 20 min) stimulates ouabain-insensitive Mg2+-ATPase at high concentration but failed to inhibit Ca2+-ATPase[2].SPAI-1 (0.01-50 μM; 10 or 20 min) also inhibits H+, K+-ATPase with an IC50 value of 5 μM[2]. |
| Name | SPAI-1 |
| CAS | 131359-77-8 |
| Shortening | LLSKRGHCPRILFRCPLSNPSNKCWRDYDCPGVKKCCEGFCGKDCLYPK (Disulfide bridge:Cys8-Cys37,Cys15-Cys41,Cys24-Cys36,Cys30-Cys45) |
| Formula | C245H386N72O65S8 |
| Molar Mass | 5628.57 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |