| Bioactivity | S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively[1]. |
| Invitro | S961 also shows high-affinity to Rat IR and Pig IR with IC50s of 0.056 nM and 0.084 nM in PEG-assay, respectively[1]. |
| Name | S961 |
| CAS | 1083433-49-1 |
| Shortening | GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY (Disulfide bridge: Cys33-Cys40) |
| Formula | C211H297N55O71S2 |
| Molar Mass | 4804.13 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |