| Bioactivity | S961 TFA is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively[1]. | ||||||
| Invitro | S961 also shows high-affinity to Rat IR and Pig IR with IC50s of 0.056 nM and 0.084 nM in PEG-assay, respectively[1]. | ||||||
| Name | S961 TFA | ||||||
| Sequence | Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40) | ||||||
| Shortening | GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY (Disulfide bridge: Cys33-Cys40) | ||||||
| Formula | C211H297N55O71S2.C2HF3O2 | ||||||
| Molar Mass | 4918.15 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light) |
S961 TFA
CAS: F: C211H297N55O71S2.C2HF3O2 W: 4918.15
S961 TFA is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of0.048, 0.027, and 630 nM for HI
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.