| Bioactivity | RyR1(3614-3643) is a biological active peptide. (the absolutely conserved peptide corresponding to the CaM-binding domain of RyR1 in all vertebrates) |
| Name | RyR1(3614-3643) |
| Sequence | Lys-Ser-Lys-Lys-Ala-Val-Trp-His-Lys-Leu-Leu-Ser-Lys-Gln-Arg-Arg-Arg-Ala-Val-Val-Ala-Cys-Phe-Arg-Met-Thr-Pro-Leu-Tyr-Asn |
| Shortening | KSKKAVWHKLLSKQRRRAVVACFRMTPLYN |
| Formula | C163H272N52O37S2 |
| Molar Mass | 3616.36 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |