| Bioactivity | Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils[1]. |
| Name | Rabbit neutrophil peptide 3b |
| Sequence | Asn-Pro-Val-Ser-Cys-Val-Arg-Asn-Lys-Gly-Ile-Cys-Val-Pro-Ile-Arg-Cys-Pro-Gly-Ser-Met-Lys-Gln-Ile-Gly-Thr-Cys-Val-Gly-Arg-Ala-Val-Lys-Cys-Cys-Arg-Lys-Lys (Disulfide bridge:C3-32;C5-C21;C11-C31) |
| Shortening | GRCVCRKQLLCSYRERRIGDCKIRGVRFPFCCPR (Disulfide bridge:C3-32;C5-C21;C11-C31) |
| Formula | C169H296N58O45S7 |
| Molar Mass | 4084.98 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Selsted ME, et al. Primary structures of six antimicrobial peptides of rabbit peritoneal neutrophils. J Biol Chem. 1985 Apr 25;260(8):4579-84. |