| Bioactivity | RALF1 peptide is endogenous signals that inhibits growth of plants through apoplast alkalinization and induction of auxin biosynthesis[1]. |
| Sequence | Ala-Thr-Thr-Lys-Tyr-Ile-Ser-Tyr-Gln-Ser-Leu-Lys-Arg-Asn-Ser-Val-Pro-Cys-Ser-Arg-Arg-Gly-Ala-Ser-Tyr-Tyr-Asn-Cys-Gln-Asn-Gly-Ala-Gln-Ala-Asn-Pro-Tyr-Ser-Arg-Gly-Cys-Ser-Lys-Ile-Ala-Arg-Cys-Arg-Ser (disulfide bridge: Cys18-Cys28, Cys41-Cys47) |
| Shortening | ATTKYISYQSLKRNSVPCSRRGASYYNCQNGAQANPYSRGCSKIARCRS (disulfide bridge: Cys18-Cys28, Cys41-Cys47) |
| Formula | C228H363N77O72S4 |
| Molar Mass | 5463.05 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Li L, et al., RALF1 peptide triggers biphasic root growth inhibition upstream of auxin biosynthesis. Proc Natl Acad Sci U S A. 2022 Aug 2;119(31):e2121058119. |