| Bioactivity | Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis[1][2]. | ||||||
| Invitro | Prolactin Releasing Peptide (1-31), human (acetate) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively[1]. | ||||||
| Name | Prolactin Releasing Peptide (1-31), human acetate | ||||||
| Sequence | Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 | ||||||
| Shortening | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 | ||||||
| Formula | C162H26N56O44S | ||||||
| Molar Mass | 3724.17 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Prolactin Releasing Peptide (1-31), human acetate
CAS: F: C162H26N56O44S W: 3724.17
Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prola
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.