PeptideDB

Prolactin Releasing Peptide (1-31), human acetate

CAS: F: C162H26N56O44S W: 3724.17

Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prola
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis[1][2].
Invitro Prolactin Releasing Peptide (1-31), human (acetate) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively[1].
Name Prolactin Releasing Peptide (1-31), human acetate
Sequence Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2
Shortening SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
Formula C162H26N56O44S
Molar Mass 3724.17
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)