PeptideDB

Prolactin-Releasing Peptide (1-31), bovine

CAS: F: C44H80N14O15 W: 3576.10

Prolactin-Releasing Peptide (1-31), bovine is a fragment of the prolactin releasing peptide (PrRP).
Data collection：peptidedb@qq.com
Contact QiTai

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Prolactin-Releasing Peptide (1-31), bovine is a fragment of the prolactin releasing peptide (PrRP)[1].
Name Prolactin-Releasing Peptide (1-31), bovine
Shortening SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2
Formula C44H80N14O15
Molar Mass 3576.10
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

NoxA1ds TFA

Substance P, [Met-OMet11]

Product Recommendation

Latest release

Hot list

Copyright © 2025 PeptideDB All Rights Reserved

Sitemaps | Contact

Is for research use only, not for human use. We do not sell to patients.