| Bioactivity | Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus[1]. |
| Name | Prepro VIP (81-122), human |
| CAS | 111366-38-2 |
| Sequence | His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-Gly-Lys-Arg-Val-Ser-Ser-Asn-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val |
| Shortening | HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV |
| Formula | C202H325N53O64S |
| Molar Mass | 4552.13 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Prepro VIP (81-122), human
CAS: 111366-38-2 F: C202H325N53O64S W: 4552.13
Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residue
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.