| Bioactivity | Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity[1]. |
| Name | Prepro-Atrial Natriuretic Factor (26-55) (human) |
| CAS | 112160-82-4 |
| Sequence | Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp |
| Shortening | NPMYNAVSNADLMDFKNLLDHLEEKMPLED |
| Formula | C152H236N38O51S3 |
| Molar Mass | 3507.92 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Vesely DL, et al. Human prepro atrial natriuretic factors 26-55, 56-92, and 104-123 increase renal guanylate cyclase activity. Biochem Biophys Res Commun. 1987 Feb 27;143(1):186-93. |