PeptideDB

Pramlintide acetate

CAS: F: C173H271N51O55S2 W: 4009.44

Pramlintide acetate is a polypeptide analogue of human amylin. Pramlintide acetate, an antidiabetic agent, is antineopla
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Pramlintide acetate is a polypeptide analogue of human amylin. Pramlintide acetate, an antidiabetic agent, is antineoplastic in colorectal cancer[1].
Invitro Pramlintide inhibits the growth of HCT-116 and HT-29 in a dose-dependent manner, with higher efficacy against the latter (IC50s of 48.67 and 9.10 μg/mL, respectively)[1]. The addition of 5, 10, and 20 μg/mL of Pramlintide to HCT-116 and HT-29 with 5-fluorouracil, Oxaliplatin, or Irinotecan induces the antiproliferative effect synergistically[1].
Name Pramlintide acetate
Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7)
Shortening KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)
Formula C173H271N51O55S2
Molar Mass 4009.44
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)