| Bioactivity | Pramlintide TFA is a polypeptide analogue of human amylin. Pramlintide TFA, an antidiabetic agent, is antineoplastic in colorectal cancer[1]. |
| Invitro | Pramlintide inhibits the growth of HCT-116 and HT-29 in a dose-dependent manner, with higher efficacy against the latter (IC50s of 48.67 and 9.10 μg/mL, respectively)[1]. The addition of 5, 10, and 20 μg/mL of Pramlintide to HCT-116 and HT-29 with 5-fluorouracil, Oxaliplatin, or Irinotecan induces the antiproliferative effect synergistically[1]. |
| Name | Pramlintide TFA |
| Sequence | Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7) |
| Shortening | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7) |
| Formula | C173H268N51F3O55S2 |
| Molar Mass | 4063.40 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Maha S Al-Keilani, et al. Pramlintide, an antidiabetic, is antineoplastic in colorectal cancer and synergizes with conventional chemotherapy. Clin Pharmacol. 2018 Mar 5;10:23-29. |
Pramlintide TFA
CAS: F: C173H268N51F3O55S2 W: 4063.40
Pramlintide TFA is a polypeptide analogue of human amylin. Pramlintide TFA, an antidiabetic agent, is antineoplastic in
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.