PeptideDB

Plectasin

CAS: F: C189H267N53O56S7 W: 4401.92

Plectasin is a peptide antibiotic derived from saprophytic fungi. Plectasin can kill pneumococcus in vitro. Plectasin ca
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Plectasin is a peptide antibiotic derived from saprophytic fungi. Plectasin can kill pneumococcus in vitro. Plectasin can alleviate experimental peritonitis and pneumonia caused by pneumococcus in mice[1].
Sequence Gly-Phe-Gly-Cys-Asn-Gly-Pro-Trp-Asp-Glu-Asp-Asp-Met-Gln-Cys-His-Asn-His-Cys-Lys-Ser-Ile-Lys-Gly-Tyr-Lys-Gly-Gly-Tyr-Cys-Ala-Lys-Gly-Gly-Phe-Val-Cys-Lys-Cys-Tyr (Disulfidebridge:Cys4-Cys30;Cys15-Cys37;Cys19-Cys39)
Shortening GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY (Disulfidebridge:Cys4-Cys30;Cys15-Cys37;Cys19-Cys39)
Formula C189H267N53O56S7
Molar Mass 4401.92
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Mygind PH, et al. Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus. Nature. 2005 Oct 13;437(7061):975-80.