| Bioactivity | Plectasin is a peptide antibiotic derived from saprophytic fungi. Plectasin can kill pneumococcus in vitro. Plectasin can alleviate experimental peritonitis and pneumonia caused by pneumococcus in mice[1]. |
| Sequence | Gly-Phe-Gly-Cys-Asn-Gly-Pro-Trp-Asp-Glu-Asp-Asp-Met-Gln-Cys-His-Asn-His-Cys-Lys-Ser-Ile-Lys-Gly-Tyr-Lys-Gly-Gly-Tyr-Cys-Ala-Lys-Gly-Gly-Phe-Val-Cys-Lys-Cys-Tyr (Disulfidebridge:Cys4-Cys30;Cys15-Cys37;Cys19-Cys39) |
| Shortening | GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY (Disulfidebridge:Cys4-Cys30;Cys15-Cys37;Cys19-Cys39) |
| Formula | C189H267N53O56S7 |
| Molar Mass | 4401.92 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Mygind PH, et al. Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus. Nature. 2005 Oct 13;437(7061):975-80. |