| Bioactivity | Phrixotoxin 2 is a highly selective KV4.2 and KV4.3-channels blocker[1]. |
| Name | Phrixotoxin 2 |
| CAS | 741738-57-8 |
| Sequence | Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Glu-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Arg-Ile-Ile-Asn-Met-NH2 (Disulfide Bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25) |
| Shortening | YCQKWMWTCDEERKCCEGLVCRLWCKRIINM-NH2 (Disulfide Bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25) |
| Formula | C169H259N49O43S8 |
| Molar Mass | 3921.69 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. M. Gostimirovic, et al. Involvement of phrixotoxin-2 sensitive KV4 family of potassium channels in the relaxation mediated by resveratrol in human saphenous vein from diabetic patients. Abstracts / Atherosclerosis 331 (2021) e56ee293. |