PeptideDB

Phrixotoxin 2

CAS: 741738-57-8 F: C169H259N49O43S8 W: 3921.69

Phrixotoxin 2 is a highly selective KV4.2 and KV4.3-channels blocker.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Phrixotoxin 2 is a highly selective KV4.2 and KV4.3-channels blocker[1].
Name Phrixotoxin 2
CAS 741738-57-8
Sequence Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Glu-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Arg-Ile-Ile-Asn-Met-NH2 (Disulfide Bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25)
Shortening YCQKWMWTCDEERKCCEGLVCRLWCKRIINM-NH2 (Disulfide Bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25)
Formula C169H259N49O43S8
Molar Mass 3921.69
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. M. Gostimirovic, et al. Involvement of phrixotoxin-2 sensitive KV4 family of potassium channels in the relaxation mediated by resveratrol in human saphenous vein from diabetic patients. Abstracts / Atherosclerosis 331 (2021) e56ee293.