| Bioactivity | Phrixotoxin 1, from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of Kv4 potassium channel[1][2]. |
| Target | Kv4 |
| Name | Phrixotoxin-1 |
| CAS | 221872-97-5 |
| Sequence | Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Ala-Arg-Lys-Cys-Cys-Glu-Gly-Leu-Val-Cys-Arg-Leu-Trp-Cys-Lys-Lys-Ile-Ile-NH2 |
| Shortening | YCQKWMWTCDSARKCCEGLVCRLWCKKII-NH2 |
| Formula | C156H246N44O37S7 |
| Molar Mass | 3554.35 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Benjamin Chagot, et al. Solution structure of Phrixotoxin 1, a specific peptide inhibitor of Kv4 potassium channels from the venom of the theraphosid spider Phrixotrichus auratus. Protein Sci. 2004 May;13(5):1197-208. [2]. Grit Schaarschmidt, et al. Characterization of Voltage-Gated Potassium Channels in Human Neural Progenitor Cells. PLoS One. 2009 Jul 8;4(7):e6168. [3]. Ryota Imai, et al. Excitability of oxytocin neurons in paraventricular nucleus is regulated by voltage-gated potassium channels Kv4.2 and Kv4.3. Biosci Biotechnol Biochem. 2019 Feb;83(2):202-211. |
Phrixotoxin-1
CAS: 221872-97-5 F: C156H246N44O37S7 W: 3554.35
Phrixotoxin 1, from the venom of the theraphosid spider Phrixotrichus auratus, is a specific peptide inhibitor of Kv4 po
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.