| Bioactivity | Phlo1a (μ-TrTx-Phlo1a) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1a has a weak inhibitory effect on Nav1.2 and Nav1.5[1]. |
| Name | Phlo1a |
| Sequence | Ala-Cys-Arg-Glu-Leu-Leu-Gly-Gly-Cys-Ser-Lys-Asp-Ser-Asp-Cys-Cys-Ala-His-Leu-Glu-Cys-Arg-Lys-Lys-Trp-Pro-Tyr-His-Cys-Val-Trp-Asp-Trp-Thr-Ile-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys29) |
| Shortening | ACRELLGGCSKDSDCCAHLECRKKWPYHCVWDWTI-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys29) |
| Formula | C178H262N52O49S6 |
| Molar Mass | 4106.69 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Ying Wu, et al. Selective Voltage-Gated Sodium Channel Peptide Toxins from Animal Venom: Pharmacological Probes and Analgesic Drug Development. ACS Chem Neurosci. 2018 Feb 21;9(2):187-197. |