PeptideDB

PhD4

CAS: F: C156H219N43O37S6 W: 3481.06

PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Ca
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Candida albicans[1].
Name PhD4
Sequence Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Phe-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Phe-Tyr-Leu-Gly-Arg-Val-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30, Cys4-Cys19,Cys9-Cys29)
Shortening ACYCRIPACFAGERRYGTCFYLGRVWAFCC (Disulfide bridge:Cys2-Cys30, Cys4-Cys19,Cys9-Cys29)
Formula C156H219N43O37S6
Molar Mass 3481.06
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Tsvetkova EV, et al. alpha-Defensins from blood leukocytes of the monkey Papio hamadryas. Biochemistry (Mosc). 2006 Aug;71(8):879-83.