| Bioactivity | PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Candida albicans[1]. |
| Name | PhD4 |
| Sequence | Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Phe-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Phe-Tyr-Leu-Gly-Arg-Val-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30, Cys4-Cys19,Cys9-Cys29) |
| Shortening | ACYCRIPACFAGERRYGTCFYLGRVWAFCC (Disulfide bridge:Cys2-Cys30, Cys4-Cys19,Cys9-Cys29) |
| Formula | C156H219N43O37S6 |
| Molar Mass | 3481.06 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Tsvetkova EV, et al. alpha-Defensins from blood leukocytes of the monkey Papio hamadryas. Biochemistry (Mosc). 2006 Aug;71(8):879-83. |