| Bioactivity | Pezadeftide is a potent antifungal peptide. Pezadeftide can enter fungal cells and cause a rapid mitochondrial response that results in hyperpolarization of the mitochondrial membrane[1]. |
| Name | Pezadeftide |
| CAS | 1907724-92-8 |
| Sequence | Ala-Lys-Val-Cys-Thr-Lys-Pro-Ser-Lys-Phe-Phe-Lys-Gly-Leu-Cys-Gly-Thr-Asp-Gly-Ala-Cys-Thr-Thr-Ala-Cys-Arg-Lys-Glu-Gly-Leu-His-Ser-Gly-Tyr-Cys-Gln-Leu-Lys-Gly-Phe-Leu-Asn-Ser-Val-Cys-Val-Cys-Arg-Lys-His-Cys |
| Shortening | AKVCTKPSKFFKGLCGTDGACTTACRKEGLHSGYCQLKGFLNSVCVCRKHC |
| Formula | C234H380N70O66S8 |
| Molar Mass | 5486.47 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Nicole L, et al. 32994 Pezadeftide is a potent antifungal peptide with rapid fungicidial activity via a unique mechanism of action. J AM ACAD DERMATOL. 2022, 87, 3. |