| Bioactivity | Peptide YY (PYY) (3-36), porcine is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite. |
| Invitro | Peptide YY (PYY) (3-36), porcine is a Y2 receptor agonist, generated via cleaving the first two amino acids at the N terminus of PYY1-36 by enzyme dipeptidyl peptidase-IV (DPP-IV), and can reduces food intake[1]. |
| Name | Peptide YY (PYY) (3-36), porcine |
| CAS | 126339-09-1 |
| Sequence | Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Shortening | AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 |
| Formula | C176H272N52O54 |
| Molar Mass | 3980.42 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Peptide YY (PYY) (3-36), porcine
CAS: 126339-09-1 F: C176H272N52O54 W: 3980.42
Peptide YY (PYY) (3-36), porcine is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite.
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.