| Bioactivity | Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors. | ||||||
| Invitro | The gut hormone peptide YY ( PYY) belongs to the pancreatic polypeptide (PP) family along with PP and neuropeptide Y (NPY). These peptides mediate their effects through the NPY receptors of which there are several subtypes (Y1, Y2, Y4, and Y5)[1]. Pancreatic polypeptide YY (Peptide YY), a small peptide consisting of 36 amino acids, is originally isolated from porcine intestine and is secreted from the neuroendocrine cells (L cells) in the mucosa of the gastrointestinal tract, but it has been localized to other locations associated with the digestive system[2]. | ||||||
| Name | Peptide YY (PYY), human | ||||||
| CAS | 118997-30-1 | ||||||
| Sequence | Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 | ||||||
| Shortening | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 | ||||||
| Formula | C194H295N55O57 | ||||||
| Molar Mass | 4309.75 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Peptide YY (PYY), human
CAS: 118997-30-1 F: C194H295N55O57 W: 4309.75
Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediat
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.