PeptideDB

Peptide F, bovine

CAS: 75718-92-2 F: C172H259N41O53S3 W: 3845.32

Peptide F, bovine is a proenkephalin peptide F from in bovine brain and adrenal medulla. Enkephalinergic system involv
Sales Email：peptidedb@qq.com
Contact QiTai

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Peptide F, bovine is a proenkephalin peptide F from in bovine brain and adrenal medulla. Enkephalinergic system involves in pain transmission[1].
Name Peptide F, bovine
CAS 75718-92-2
Shortening YGGFMKKMDELYPLEVEEEANGGEVLGKRYGGFM
Formula C172H259N41O53S3
Molar Mass 3845.32
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Angiotensin III, human, mouse TFA

PUMA BH3 TFA

Product Recommendation

Latest release

Hot list

Copyright © 2025 PeptideDB All Rights Reserved

Sitemaps | Contact

Is for research use only, not for human use. We do not sell to patients.