| Bioactivity | Peptide B, bovine is an immunoregulatory peptide in bovine milk. Peptide B, bovine comes from αs1-casein B-8P (f1-13), is the major peptide produced during the ripening process with antihypertensive effects[1][2]. |
| Name | Peptide B, bovine |
| CAS | 87713-86-8 |
| Shortening | FAEPLPSEEEGESYSKEVPEMEKRYGGFMRF |
| Formula | C163H239N39O53S2 |
| Molar Mass | 3656.99 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Peptide B, bovine
CAS: 87713-86-8 F: C163H239N39O53S2 W: 3656.99
Peptide B, bovine is an immunoregulatory peptide in bovine milk. Peptide B, bovine comes from αs1-casein B-8P (f1-13),
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.