Peptide A5K acetate_product_DataBase

CAS: F: C182H275N55O48S.xC2H4O2 W: 4033.54 (free acid)

Peptide A5K acetate is a INF7-TAT derivative and is used for CRISPR RNP delivery into T cells. Peptide A5K acetate effec

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	Peptide A5K acetate is a INF7-TAT derivative and is used for CRISPR RNP delivery into T cells. Peptide A5K acetate effectively promotes the delivery of Cas9 RNP to natural killer (NK) cells[1].
Target	IC50: RNP Delivery
Name	Peptide A5K acetate
Sequence	Gly-Leu-Phe-Glu-Lys-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg
Shortening	GLFEKIEGFIENGWEGMIDGWYGYGRKKRRQRR
Formula	C182H275N55O48S.xC2H4O2
Molar Mass	4033.54 (free acid)
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Dana V Foss, et al. Peptide-mediated delivery of CRISPR enzymes for the efficient editing of primary human lymphocytes. Nat Biomed Eng. 2023 May;7(5):647-660.

PeptideDB