| Bioactivity | Pepinh-TRIF (TFA) is a 30 aa peptide that blocks TIR-domain-containing adapter-inducing interferon-β (TRIF) signaling by interfering with TLR-TRIF interaction[1]. | ||||||
| Invitro | Pepinh-TRIF (40 μM, 6 hours) blocks the expression and production of IL-33 stimulated by polyI:C or flagellin, and also greatly suppresses the stimulated IκB-α phosphorylation and degradation in HCECs[1].Pepinh-TRIF (40 μM, 6 hours) suppresses NF-κB activation with p65 protein nuclear translocation [1]. Western Blot Analysis[1] Cell Line: | ||||||
| Name | Pepinh-TRIF TFA | ||||||
| Shortening | RQIKIWFQNRRMKWKKFCEEFQVPGRGELH-NH2 | ||||||
| Formula | C180H279F3N58O40S2 | ||||||
| Molar Mass | 4016.63 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
Pepinh-TRIF TFA
CAS: F: C180H279F3N58O40S2 W: 4016.63
Pepinh-TRIF (TFA) is a 30 aa peptide that blocks TIR-domain-containing adapter-inducing interferon-β (TRIF) signaling b
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.