PeptideDB

Pepinh-MYD

CAS: 1421052-89-2 F: C151H248N50O35S2 W: 3388.03

Pepinh-MYD is a MyD88 inhibitor that contains a domain sequence from MyD88 TIR and a protein transduction sequence, enab
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Pepinh-MYD is a MyD88 inhibitor that contains a domain sequence from MyD88 TIR and a protein transduction sequence, enabling it to penetrate the cell membrane. Pepinh-MYD interferes with MyD88-mediated TLR signaling pathways, thereby inhibiting related immune responses. It holds potential for studying the role of MyD88 in viral infections[1].
CAS 1421052-89-2
Sequence Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Arg-Asp-Val-Leu-Pro-Gly-Thr-Cys-Val-Asn-Ser-NH2
Shortening RQIKIWFQNRRMKWKKRDVLPGTCVNS-NH2
Formula C151H248N50O35S2
Molar Mass 3388.03
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Takaki H, et al. The MyD88 pathway in plasmacytoid and CD4+ dendritic cells primarily triggers type I IFN production against measles virus in a mouse infection model. J Immunol. 2013 Nov 1;191(9):4740-7.