| Bioactivity | Pepinh-MYD is a MyD88 inhibitor that contains a domain sequence from MyD88 TIR and a protein transduction sequence, enabling it to penetrate the cell membrane. Pepinh-MYD interferes with MyD88-mediated TLR signaling pathways, thereby inhibiting related immune responses. It holds potential for studying the role of MyD88 in viral infections[1]. |
| CAS | 1421052-89-2 |
| Sequence | Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Arg-Asp-Val-Leu-Pro-Gly-Thr-Cys-Val-Asn-Ser-NH2 |
| Shortening | RQIKIWFQNRRMKWKKRDVLPGTCVNS-NH2 |
| Formula | C151H248N50O35S2 |
| Molar Mass | 3388.03 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Takaki H, et al. The MyD88 pathway in plasmacytoid and CD4+ dendritic cells primarily triggers type I IFN production against measles virus in a mouse infection model. J Immunol. 2013 Nov 1;191(9):4740-7. |
Pepinh-MYD
CAS: 1421052-89-2 F: C151H248N50O35S2 W: 3388.03
Pepinh-MYD is a MyD88 inhibitor that contains a domain sequence from MyD88 TIR and a protein transduction sequence, enab
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.