| Bioactivity | Penetratin-PI3Kγ(126-150) is a peptide inhibitor of ΡI3Κγ that plays an important role in respiratory system diseases[1]. |
| Name | Penetratin-PI3Kγ(126-150) |
| Sequence | Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Gly-Lys-Ala-Thr-His-Arg-Ser-Pro-Gly-Gln-Ile-His-Leu-Val-Gln-Arg-His-Pro-Pro-Ser-Glu-Glu-Ser-Gln-Ala-Phe |
| Shortening | RQIKIWFQNRRMKWKKGKATHRSPGQIHLVQRHPPSEESQAF |
| Formula | C229H362N76O57S |
| Molar Mass | 5123.86 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Hirsch Emilio, et al. Novel PI3k gamma inhibitor peptide for treatment of respiratory system diseases. World Intellectual Property Organization, WO2016103176 A1 2016-06-30 |
Penetratin-PI3Kγ(126-150)
CAS: F: C229H362N76O57S W: 5123.86
Penetratin-PI3Kγ(126-150) is a peptide inhibitor of ΡI3Κγ that plays an important role in respiratory system disease
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.