PeptideDB

Pediocin PA 1 TFA

CAS: F: C196H293N61O60S5.xC2HF3O2 W: 4624.12 (free base)

Pediocin PA-1 TFA is a broad-spectrum lactic acid bacterial bacteriocin that inhibits the activity of foodborne pathogen
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Pediocin PA-1 TFA is a broad-spectrum lactic acid bacterial bacteriocin that inhibits the activity of foodborne pathogens such as Listeria monocytogenes and Gram-positive bacteria. Pediocin PA-1 TFA can be used as a food biopreservative[1].
Sequence Lys-Tyr-Tyr-Gly-Asn-Gly-Val-Thr-Cys-Gly-Lys-His-Ser-Cys-Ser-Val-Asp-Trp-Gly-Lys-Ala-Thr-Thr-Cys-Ile-Ile-Asn-Asn-Gly-Ala-Met-Ala-Trp-Ala-Thr-Gly-Gly-His-Gln-Gly-Asn-His-Lys-Cys (Disulfidebridge:Cys9-Cys14;Cys24-Cys44)
Shortening KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC (Disulfidebridge:Cys9-Cys14;Cys24-Cys44)
Formula C196H293N61O60S5.xC2HF3O2
Molar Mass 4624.12 (free base)
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Rodríguez JM, et al. Pediocin PA-1, a wide-spectrum bacteriocin from lactic acid bacteria. Crit Rev Food Sci Nutr. 2002;42(2):91-121.