| Bioactivity | Pe1b (μ-TrTx-Pe1b) is a selective Nav1.7 inhibitor with an IC50 of 167 nM[1]. |
| Target | IC50: 167 nM (Nav1.7), 696 nM (Nav1.6), 3.49 μM (Nav1.2), ＞10 μM (Nav1.5) |
| Name | Pe1b |
| Sequence | Glu-Cys-Arg-Tyr-Trp-Leu-Gly-Gly-Cys-Ser-Lys-Thr-Gly-Asp-Cys-Cys-Glu-His-Leu-Ser-Cys-Ser-Pro-Lys-Trp-His-Trp-Cys-Val-Trp-Asp-Gly-Thr-Phe (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys28) |
| Shortening | ECRYWLGGCSKTGDCCEHLSCSPKWHWCVWDGTF (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys28) |
| Formula | C175H237N47O49S6 |
| Molar Mass | 3975.43 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Rupasinghe DB, et al. Mutational analysis of ProTx-I and the novel venom peptide Pe1b provide insight into residues responsible for selective inhibition of the analgesic drug target NaV1.7. Biochem Pharmacol. 2020 Nov;181:114080. |