PeptideDB

Pe1b

CAS: F: C175H237N47O49S6 W: 3975.43

Pe1b (μ-TrTx-Pe1b) is a selective Nav1.7 inhibitor with an IC50 of 167 nM.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Pe1b (μ-TrTx-Pe1b) is a selective Nav1.7 inhibitor with an IC50 of 167 nM[1].
Target IC50: 167 nM (Nav1.7), 696 nM (Nav1.6), 3.49 μM (Nav1.2), >10 μM (Nav1.5)
Name Pe1b
Sequence Glu-Cys-Arg-Tyr-Trp-Leu-Gly-Gly-Cys-Ser-Lys-Thr-Gly-Asp-Cys-Cys-Glu-His-Leu-Ser-Cys-Ser-Pro-Lys-Trp-His-Trp-Cys-Val-Trp-Asp-Gly-Thr-Phe (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys28)
Shortening ECRYWLGGCSKTGDCCEHLSCSPKWHWCVWDGTF (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys28)
Formula C175H237N47O49S6
Molar Mass 3975.43
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Rupasinghe DB, et al. Mutational analysis of ProTx-I and the novel venom peptide Pe1b provide insight into residues responsible for selective inhibition of the analgesic drug target NaV1.7. Biochem Pharmacol. 2020 Nov;181:114080.