| Bioactivity | Parstatin(human), a cell-penetrating PAR-1 thrombin receptor agonist peptide, is a potent inhibitor of angiogenesis[1][2]. |
| Invitro | Parstatin (0-10 µM) increases recovery of LVDP in a concentration-dependent manner. The optimal concentration was 1 µM which produced a 23% recovery of LVDP[2]. |
| Name | Parstatin(human) |
| CAS | 1065755-99-8 |
| Shortening | MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR |
| Formula | C191H330N64O53S3 |
| Molar Mass | 4467.26 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |