| Bioactivity | Pardaxin P5 is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM[1]. |
| Name | Pardaxin P5 |
| CAS | 67995-63-5 |
| Sequence | -Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala-Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Asp-Gln-Glu |
| Shortening | GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE |
| Formula | C156H250N36O47 |
| Molar Mass | 3381.87 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Naoki Saigo, et al. Electrophysiological Analysis of Antimicrobial Peptides in Diverse Species. ACS Omega. 2019 Aug 6;4(8):13124-13130. |